PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn298101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 231aa    MW: 26060.8 Da    PI: 4.4678
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn298101genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.5e-081443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     +g W++eEde+l + ++++G g+W+t+++ 
       Achn298101 14 KGLWSPEEDEKLFNHITRFGIGCWSTVPKL 43
                     678************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.44E-7643IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-11743IPR009057Homeodomain-like
PROSITE profilePS500906.725942IPR017877Myb-like domain
CDDcd001671.18E-41742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRQSGCVKP KLRKGLWSPE EDEKLFNHIT RFGIGCWSTV PKLAAAMSST IFYEGGLNLT  60
EGSREQFENK PVFDPLLVYE FQGNADPIGY NSSFSAQYLR PYSQSYQEVN SHLGFNSMPN  120
LTSFDHQNVA ETDFSGNSTS QMSSLLFSEV KESSSNSSIM KNMMENAEFS WDTDKFESVF  180
QCQNGIKYEE MKPSPWPEGQ LQNHNSEYFS SYPLTSLSED LARAPMDVFQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278063.16e-51PREDICTED: protein ODORANT1 isoform X1
RefseqXP_010663107.19e-52PREDICTED: transcription factor MYB39 isoform X2
TrEMBLA0A061FTT73e-49A0A061FTT7_THECC; Myb domain protein 86
STRINGPOPTR_0015s09430.13e-41(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1877122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-19myb domain protein 86